Cat#:FPA-36079P;Product Name:Rabbit Anti-RNA Polymerase II p14.5 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human RNA Polymerase II p14.5 aa 63-115. Sequence: DELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYY VCT ;Species Reactivity:Human Predicted to work with: Mouse, Cow, Pig;Isotype:IgG;Application:ICC/IF;Storage Buffer:pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;