• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-RIP3 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-36025P
  • Product Name:
  • Rabbit Anti-RIP3 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to Human RIP3 aa 168-217. Immunogen is located within the provided sequence. Sequence: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG
  • Species Reactivity:
  • Mouse, Human Predicted to work with: Rat, Horse, Dog, Pig
  • Isotype:
  • IgG
  • Application:
  • IP, WB, IHC-P
  • Storage Buffer:
  • Preservative: None Constituents: 2% Sucrose, PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-RIP2 Polyclonal Antibody-FPA-36024P
  • Online Inquiry

    refresh