Rabbit Anti-RIP3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-36025P

• Product Name:
• Rabbit Anti-RIP3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human RIP3 aa 168-217. Immunogen is located within the provided sequence. Sequence: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Horse, Dog, Pig

• Isotype:
• IgG

• Application:
• IP, WB, IHC-P

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid