Cat#:FPA-35909P;Product Name:Rabbit Anti-RIBC1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within internal sequence aa 215-264 ( ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM ) of Human RIBC1 (NP_001026915). ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within internal sequence aa 215-264 ( ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM ) of Human RIBC1 (NP_001026915).
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Cow, Dog, Pig
Isotype:
IgG
Application:
WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.