Cat#:FPA-35832P;Product Name:Rabbit Anti-RHBL3 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human RHBL3 aa 45-106. Sequence: QFDPGNTGYISTGKFRSLLESHSSKLDPHKREVLLALADSHADGQIGYQD FVSLMSNKRSNS ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:IHC-P;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;