Cat#:FPA-35817P;Product Name:Rabbit Anti-RHAG Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human RHAG aa 1-50 (N terminal). The exact sequence is proprietary. Sequence: MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFEL ;Species Reactivity:Human;Isotype:IgG;Application:WB;Storage Buffer:pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 50% Glycerol, 0.87% Sodium chloride, 49% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human RHAG aa 1-50 (N terminal). The exact sequence is proprietary. Sequence: MRFTFPLMAIVLEIAMIVLFGLFVEYETDQTVLEQLNITKPTDMGIFFEL