• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-RGR Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-35754P
  • Product Name:
  • Rabbit Anti-RGR Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to a region within N terminal aa 76-125 ( SLLRVSHRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTRS ) of Human RGR, isoform 2 (NP_002912).
  • Species Reactivity:
  • Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Pig, Zebrafish
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Constituents: 98% PBS, 2% Sucrose
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-RGR Polyclonal Antibody-FPA-35753P
  • Online Inquiry

    refresh