Rabbit Anti-RG9MTD1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48164P

• Product Name:
• Rabbit Anti-RG9MTD1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human PINX1 aa 353-403 (C terminal). The exact sequence is proprietary. NCBI Accession No. NP_060289.2. Sequence: LDQMIRILLCLKNNGNWQEALQFVPKRKHTGFLEISQHSQEFINRLKKAK T Database link: Q7L0Y3 Run BLAST with Run BLAST with

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• IP

• Storage Buffer:
• Immunogen affinity purified

• Storage Procedures:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8.

• Clonality:
• Polyclonal

• Form:
• Liquid