• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-RG9MTD1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-48164P
  • Product Name:
  • Rabbit Anti-RG9MTD1 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human PINX1 aa 353-403 (C terminal). The exact sequence is proprietary. NCBI Accession No. NP_060289.2. Sequence: LDQMIRILLCLKNNGNWQEALQFVPKRKHTGFLEISQHSQEFINRLKKAK T Database link: Q7L0Y3 Run BLAST with Run BLAST with
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • IP
  • Storage Buffer:
  • Immunogen affinity purified
  • Storage Procedures:
  • Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-RFXAP Polyclonal Antibody-FPA-48163P
  • Online Inquiry

    refresh