Rabbit Anti-RFX1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-35699P

• Product Name:
• Rabbit Anti-RFX1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within the internal sequence aa 900-949 (ETPIAVMGEFANLATSLNPLDPDKDEEEEEEEESEDELPQDISLAAGGE S) of Human RFX1 (NP_002909).

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Dog, Saccharomyces cerevisiae

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid