Rabbit Anti-Retinoic Acid Receptor gamma 2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-35612P

• Product Name:
• Rabbit Anti-Retinoic Acid Receptor gamma 2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human Retinoic Acid Receptor gamma 2 aa 1-65 (N terminal). Sequence: MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLG QPDLPKEMASLSVET

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat

• Isotype:
• IgG

• Application:
• IHC-P, ICC/IF, WB

• Storage Buffer:
• pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid