Rabbit Anti-Replication and transcription activator Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48150P

• Product Name:
• Rabbit Anti-Replication and transcription activator Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Herpesvirus Replication and transcription activator aa 180-230 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. Sequence: EKEGLLSSKFKAFCKWVFTYPVLEEMFQTMVSSKTGHLTDDVKDVRALIK T Database link:

• Species Reactivity:
• Human herpesvirus

• Isotype:
• IgG

• Application:
• IHC-P, WB

• Storage Buffer:
• Protein A purified

• Storage Procedures:
• Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 0.01% BSA

• Clonality:
• Polyclonal

• Form:
• Liquid