Rabbit Anti-Renalase Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-35516P

• Product Name:
• Rabbit Anti-Renalase Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal aa 203-252 ( GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFGV ) of Mouse Renalase (NP_001161290).

• Species Reactivity:
• Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Human, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid