Rabbit Anti-RDM1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-35445P

• Product Name:
• Rabbit Anti-RDM1 Polyclonal Antibody

• Formulation:
• There are 11 isoforms produced by alternative promoter usage and alternative splicing.Isoform 1 = RDM1alpha; Long N-terminal form. Isoform 2 = DeltaN-RDM1alpha; Short N-terminal form. Isoform 3 = RDM1beta. Isoform 4 = DeltaN-RDM1beta. Isoform 5 = RDM1gamm

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human RDM1 aa 127-172. The exact sequence is proprietary. Sequence: CSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDC

• Species Reactivity:
• Mouse, Rat, Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• pH: 7.3 Preservative: 0.05% Sodium azide Constituent: 99% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal