Cat#:FPA-35443P;Product Name:Rabbit Anti-RDH8 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within internal sequence aa 111-160 (FDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASK F) of Human RDH8 (NP_056540). ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 97% PBS, 2% Sucrose;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within internal sequence aa 111-160 (FDTNFFGAVRLVKAVLPGMKRRRQGHIVVISSVMGLQGVIFNDVYAASK F) of Human RDH8 (NP_056540).
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
Isotype:
IgG
Application:
WB
Storage Buffer:
Constituents: 97% PBS, 2% Sucrose
Storage Procedures:
Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.