• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-RBP2 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-35368P
  • Product Name:
  • Rabbit Anti-RBP2 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide conjugated to KLH, corresponding to a region within internal sequence aa 63-92, VDFTVGVEFDEYTKSLDNRHVKALVTWEGD , of Human RBP2
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • Preservative: 0.09% Sodium Azide Constituents: PBS
  • Storage Procedures:
  • Store at 4°C (up to 6 months). Store at -20°C long term.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Goat Anti-RBP1 Polyclonal Antibody-FPA-35367P
  • Online Inquiry

    refresh