Rabbit Anti-RBP2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-35368P

• Product Name:
• Rabbit Anti-RBP2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide conjugated to KLH, corresponding to a region within internal sequence aa 63-92, VDFTVGVEFDEYTKSLDNRHVKALVTWEGD , of Human RBP2

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: 0.09% Sodium Azide Constituents: PBS

• Storage Procedures:
• Store at 4°C (up to 6 months). Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid