Cat#:FPA-35349P;Product Name:Rabbit Anti-RBM7 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human RBM7 aa 195-253. Sequence: SSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDRNHDD WSHDYDNRR ;Species Reactivity:Human Predicted to work with: Cow;Isotype:IgG;Application:IHC-P, ICC/IF;Storage Buffer:pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, 59% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;