Cat#:FPA-35302P;Product Name:Rabbit Anti-RBM22 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide (Human). Amino acid regions from which the immunogen sequence was derived, KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF .;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog;Isotype:IgG;Application:WB, IHC-P, ELISA;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.;