Rabbit Anti-RAVER2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-35226P

• Product Name:
• Rabbit Anti-RAVER2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal aa 468-517 ( ITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQ ) of Human RAVER2 (NP_060681).

• Species Reactivity:
• Human Predicted to work with: Rabbit, Cow, Cat

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: 0% None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid