Rabbit Anti-RASL10A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-35182P

• Product Name:
• Rabbit Anti-RASL10A Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal aa 18-67 ( TAIIRQFLFGDYPERHRPTDSPCLYRPAVLLDGAVYDLSIRDGDVAGPGS ) of Mouse Rasl10a (NP_660251).

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Chimpanzee, Macaque monkey, Gorilla, Chinese hamster, Common marmoset, Orangutan, African bush elephant

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituent: 100% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.

• Clonality:
• Polyclonal

• Form:
• Liquid