Rabbit Anti-RASGRF1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-35167P

• Product Name:
• Rabbit Anti-RASGRF1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human RASGRF1 aa 107-155. Also detects isoform 1 with immunogen from aa 893 to 942 (full protein lenght = 1275). Sequence: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Zebrafish

• Isotype:
• IgG

• Application:
• ICC/IF, WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid