Cat#:FPA-35101P;Product Name:Rabbit Anti-RAP2C Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human RAP2C aa 97-146. The exact sequence is proprietary. NP_067006.3. Sequence: RDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETS ;Species Reactivity:Human Predicted to work with: Mouse;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.4 Preservative: 0.02% Sodium azide Constituents: 0.87% Sodium chloride, 50% Glycerol, 49% PBS PBS (without Mg2+, Ca2+);Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human RAP2C aa 97-146. The exact sequence is proprietary. NP_067006.3. Sequence: RDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETS