Rabbit Anti-RAG1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-34968P

• Product Name:
• Rabbit Anti-RAG1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within C terminal aa 946- 995( IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT ) of Mouse RAG1 (NP_033045).

• Species Reactivity:
• Mouse Predicted to work with: Rat, Horse, Human, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 97% PBS, 2% Sucrose

• Storage Procedures:
• Store at -20°C. Stable for 12 months at -20°C.

• Clonality:
• Polyclonal

• Form:
• Liquid