Rabbit Anti-R3HCC1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-34637P

• Product Name:
• Rabbit Anti-R3HCC1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human R3HCC1 aa 164-213 (C terminal). The exact sequence is proprietary. Isoform 2. Genbank: NP_001129580 Sequence: VDDTHALGIFPCLASAAEALTREFSVLKIRPLTQGTKQSKLKALQRPKLL

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 98% PBS, 2% Sucrose

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid