Rabbit Anti-PTP1B Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-34388P

• Product Name:
• Rabbit Anti-PTP1B Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human PTP1B aa 16-65. The exact sequence is proprietary. (NP_002818.1). Sequence: WAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDND

• Species Reactivity:
• Mouse, Rat, Human, African green monkey

• Isotype:
• IgG

• Application:
• WB, IHC-P

• Storage Buffer:
• pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride PBS without Mg2+ and Ca2+.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid