Rabbit Anti-PTF1A Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-34328P

• Product Name:
• Rabbit Anti-PTF1A Polyclonal Antibody

• Formulation:
• PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas.

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human PTF1A aa 1-50 (N terminal). Sequence: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Zebrafish

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal