Rabbit Anti-PTCD3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-34305P

• Product Name:
• Rabbit Anti-PTCD3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human PTCD3 aa 97-146. The exact sequence is proprietary. Sequence: LEVIPKIWKDSKEYGHTFRSDLREEILMLMARDKHPPELQVAFADCAADI

• Species Reactivity:
• Human Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Constituents: 98% PBS, 2% Sucrose

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid