Rabbit Anti-PSPC1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-34278P

• Product Name:
• Rabbit Anti-PSPC1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human PSPC1 aa 1-50. The exact sequence is proprietary. NP_001035879.1 Sequence: MMLRGNLKQVRIEKNPARLRALESAVGESEPAAAAAMALALAGEPAPPAP

• Species Reactivity:
• Mouse, Human

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 0.1% BSA, 99% Tris buffered saline pH 7 to 8

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid