• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-PSPC1 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-34278P
  • Product Name:
  • Rabbit Anti-PSPC1 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide within Human PSPC1 aa 1-50. The exact sequence is proprietary. NP_001035879.1 Sequence: MMLRGNLKQVRIEKNPARLRALESAVGESEPAAAAAMALALAGEPAPPAP
  • Species Reactivity:
  • Mouse, Human
  • Isotype:
  • IgG
  • Application:
  • WB, IP
  • Storage Buffer:
  • Preservative: 0.09% Sodium azide Constituents: 0.1% BSA, 99% Tris buffered saline pH 7 to 8
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-PSPC1 Polyclonal Antibody-FPA-34277P
  • Online Inquiry

    refresh