Rabbit Anti-Psoriasin Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-34270P

• Product Name:
• Rabbit Anti-Psoriasin Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Mouse Psoriasin aa 40-80 conjugated to keyhole limpet haemocyanin. Sequence: LDSVPRFMDTLGRRQPYYITELFRAADKNKDNQICFDEFLY

• Species Reactivity:
• Rat, Human Predicted to work with: Mouse

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid