Rabbit Anti-PSMG2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-48075P

• Product Name:
• Rabbit Anti-PSMG2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant fragment corresponding to Human PSMG2 aa 14-89. Sequence: GFTLLMPAVSVGNVGQLAMDLIISTLNMSKIGYFYTDCLVPMVGNNPYAT TEGNSTELSINAEVYSLPSRKLVALQ Database link: Q969U7 Run BLAST with Run BLAST with

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Cow

• Isotype:
• IgG

• Application:
• IHC-P

• Storage Procedures:
• pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol

• Clonality:
• Polyclonal

• Form:
• Liquid