Cat#:FPA-34265P;Product Name:Rabbit Anti-PSMG1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within internal region aa 239-288 ( VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT ) of Human PSMG1 (NP_003711) ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig;Isotype:IgG;Application:ELISA, WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.;
Synthetic peptide corresponding to a region within internal region aa 239-288 ( VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT ) of Human PSMG1 (NP_003711)
Species Reactivity:
Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig
Isotype:
IgG
Application:
ELISA, WB
Storage Buffer:
Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:
Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.