Cat#:FPA-34153P;Product Name:Rabbit Anti-PSF1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human PSF1 aa 50-100. The exact sequence is proprietary. (NP_066545.3). Sequence: AKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLP N ;Species Reactivity:Human Predicted to work with: Rabbit, Dog, Pig, Xenopus laevis, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Xenopus tropicalis;Isotype:IgG;Application:IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human PSF1 aa 50-100. The exact sequence is proprietary. (NP_066545.3). Sequence: AKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLP N
Species Reactivity:
Human Predicted to work with: Rabbit, Dog, Pig, Xenopus laevis, Chimpanzee, Cynomolgus monkey, Rhesus monkey, Gorilla, Xenopus tropicalis
Isotype:
IgG
Application:
IP
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.