Rabbit Anti-Protor-1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-33974P

• Product Name:
• Rabbit Anti-Protor-1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Protor-1 aa 225-275. The exact sequence is proprietary. (NP_851850.1). Sequence: THSCILEKRLLRRSRSGDVLAKNPVVRSKSYNTPLLNPVQEHEAEGAAAG G

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Cow, Dog, Turkey, Pig, Chimpanzee, Rhesus monkey, Chinese hamster

• Isotype:
• IgG

• Application:
• IP

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid