Cat#:FPA-33843P;Product Name:Rabbit Anti-Proteasome 20S C2 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human Proteasome 20S C2 aa 213-263. Sequence: GIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPME H ;Species Reactivity:Human Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Orangutan;Isotype:IgG;Application:WB, IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate Note: pH: 7 to 8;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.;