• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-Proteasome 20S C2 Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-33843P
  • Product Name:
  • Rabbit Anti-Proteasome 20S C2 Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Synthetic peptide corresponding to Human Proteasome 20S C2 aa 213-263. Sequence: GIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPME H
  • Species Reactivity:
  • Human Predicted to work with: Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Chimpanzee, Ferret, Rhesus monkey, Gorilla, Orangutan
  • Isotype:
  • IgG
  • Application:
  • WB, IP
  • Storage Buffer:
  • Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate Note: pH: 7 to 8
  • Storage Procedures:
  • Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-Proteasome 20S C2 Polyclonal Antibody-FPA-33842P
  • Online Inquiry

    refresh