Rabbit Anti-Proteasome 20S beta 3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-33831P

• Product Name:
• Rabbit Anti-Proteasome 20S beta 3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human Proteasome 20S beta 3 aa 50-100. Sequence: YIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKR F

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Xenopus laevis, Rhesus monkey, Gorilla, Tilapia, Chinese hamster, Orangutan, Xenopus tropicalis

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate Note: pH 7-8

• Storage Procedures:
• Store at 4°C.

• Clonality:
• Polyclonal

• Form:
• Liquid