Rabbit Anti-Proteasome 20S alpha 2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-33822P

• Product Name:
• Rabbit Anti-Proteasome 20S alpha 2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to Human Proteasome 20S alpha 2 aa 184-234. Sequence: LEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAI A

• Species Reactivity:
• Mouse, Human Predicted to work with: Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Chimpanzee, Rhesus monkey, Gorilla, Chinese hamster, Orangutan, African bush elephant, Platypus

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate Note: pH 7-8

• Storage Procedures:
• Store at 4°C.

• Clonality:
• Polyclonal

• Form:
• Liquid