Cat#:FPA-33650P;Product Name:Rabbit Anti-Profilin 4 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Fusion protein corresponding to Human Profilin 4 aa 1-129. Full length human Profilin 4. The identity of the protein fusion partner is GST. Sequence: MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVTPSDVRTLVN GFAKNPLQARREGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLL VAT;Species Reactivity:Human;Isotype:IgG;Application:IHC-P;Storage Buffer:pH: 7.3 Preservative: 0.05% Sodium azide Constituents: 50% Glycerol, 49% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Fusion protein corresponding to Human Profilin 4 aa 1-129. Full length human Profilin 4. The identity of the protein fusion partner is GST. Sequence: MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVTPSDVRTLVN GFAKNPLQARREGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLL VAT