Cat#:FPA-33627P;Product Name:Rabbit Anti-Procathepsin L + Cathepsin L Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human Procathepsin L + Cathepsin L aa 104-149. Sequence: KVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEG ;Species Reactivity:Mouse, Rat, Human Predicted to work with: Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:pH: 7.20 Preservative: 0.0975% Sodium azide Constituent: 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;