Rabbit Anti-PRMT3 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-33572P

• Product Name:
• Rabbit Anti-PRMT3 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N terminal aa 1 - 50 ( MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPC ) of Human PRMT3 (NP_005779.1).

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB, IP

• Storage Buffer:
• Preservative: 0.09% Sodium Azide Constituents: Tris citrate/phosphate, pH 7.0-8.0

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid