Rabbit Anti-PRAMEF10 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-33407P

• Product Name:
• Rabbit Anti-PRAMEF10 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide, corresponding to a region within internal sequence aa 395-444 (DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREV R) of Human PRAMEF10 (NP_001034450).

• Species Reactivity:
• Human Predicted to work with: Rabbit, Cat

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid