Cat#:FPA-33328P;Product Name:Rabbit Anti-PPP2R5D Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to Human PPP2R5D aa 544-593. NP_006236.1. Sequence: IQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEE ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit;Isotype:IgG;Application:WB, IHC-P;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride PBS (without Mg2+, Ca2+);Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;