Cat#:FPA-33178P;Product Name:Rabbit Anti-PPFIBP1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human PPFIBP1 aa 175-225. The exact sequence is proprietary. (NP_803193.2). Sequence: EISNLKLKLTAVEKDRLDYEDKFRDTEGLIQEINDLRLKVSEMDSERLQY E ;Species Reactivity:Mouse, Human Predicted to work with: Sheep, Rabbit, Horse, Cow, Cat, Dog, Pig, Chimpanzee, Rhesus monkey, Orangutan;Isotype:IgG;Application:WB, IP;Storage Buffer:Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;
Synthetic peptide within Human PPFIBP1 aa 175-225. The exact sequence is proprietary. (NP_803193.2). Sequence: EISNLKLKLTAVEKDRLDYEDKFRDTEGLIQEINDLRLKVSEMDSERLQY E
Species Reactivity:
Mouse, Human Predicted to work with: Sheep, Rabbit, Horse, Cow, Cat, Dog, Pig, Chimpanzee, Rhesus monkey, Orangutan
Isotype:
IgG
Application:
WB, IP
Storage Buffer:
Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8
Storage Procedures:
Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.