Rabbit Anti-POP4 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-33060P

• Product Name:
• Rabbit Anti-POP4 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• The region of Human POP4 from which the exact immunogen sequence was derived is aa 172-220 EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL . The exact sequence is proprietary information.

• Species Reactivity:
• Human Predicted to work with: Mouse, Rat, Cow, Dog, Zebrafish

• Isotype:
• IgG

• Application:
• WB, IHC-P, ELISA

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid