Rabbit Anti-POLE Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-32966P

• Product Name:
• Rabbit Anti-POLE Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Recombinant full length protein corresponding to Human POLE aa 1-370. This sequence corresponds to aa 1917-2286 fragment from Swissprot Q07864. Sequence: MDPSNYGGIKGKVSSRIHCGLQDSQKAGGAEDEQENEDDEEERDGEEEEE AEESNVEDLLENNWNILQFLPQAASCQNYFLMIVSAYIVAVYHCMKDGLR

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• pH: 7.2 Constituent: 100% PBS

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid