• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-POLE Polyclonal Antibody Online Inquiry

  • Cat#:
  • FPA-32966P
  • Product Name:
  • Rabbit Anti-POLE Polyclonal Antibody
  • Host Species:
  • Rabbit
  • Immunogen:
  • Recombinant full length protein corresponding to Human POLE aa 1-370. This sequence corresponds to aa 1917-2286 fragment from Swissprot Q07864. Sequence: MDPSNYGGIKGKVSSRIHCGLQDSQKAGGAEDEQENEDDEEERDGEEEEE AEESNVEDLLENNWNILQFLPQAASCQNYFLMIVSAYIVAVYHCMKDGLR
  • Species Reactivity:
  • Human
  • Isotype:
  • IgG
  • Application:
  • WB
  • Storage Buffer:
  • pH: 7.2 Constituent: 100% PBS
  • Storage Procedures:
  • Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.
  • Clonality:
  • Polyclonal
  • Form:
  • Liquid
  • Pre product:Rabbit Anti-POLE Polyclonal Antibody-FPA-32965P
  • Online Inquiry

    refresh