Cat#:FPA-32886P;Product Name:Rabbit Anti-PNMA1 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within aa 252 - 301 (NTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANH S) of Human (NP_006020).;Species Reactivity:Human Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.;