Rabbit Anti-Platelet Activating Receptor H963 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-32658P

• Product Name:
• Rabbit Anti-Platelet Activating Receptor H963 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Platelet Activating Receptor H963 aa 141-190 (internal sequence). The exact sequence is proprietary. (NP_037440.3) Sequence: MVLLIMVPNMMIPIKDIKEKSNVGCMEFKKEFGRNWHLLTNFICVAIFLN

• Species Reactivity:
• Mouse, Human Predicted to work with: Cow

• Isotype:
• IgG

• Application:
• WB, IHC-P, ICC/IF

• Storage Buffer:
• pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 0.87% Sodium chloride, 50% Glycerol PBS is without Mg2+, Ca2+

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid