Rabbit Anti-Plasminogen Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-32645P

• Product Name:
• Rabbit Anti-Plasminogen Polyclonal Antibody

• Formulation:
• Cleaved into the following 5 chains: 1.Plasmin heavy chain A2.Activation peptide3.Angiostatin4.Plasmin heavy chain A, short form5. Plasmin light chain B

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within internal region aa 611-660 ( LISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE ) of Human Plasminogen (NP_000292)

• Species Reactivity:
• Human Predicted to work with: Chicken, Pig

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal