Rabbit Anti-Pin1 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-32322P

• Product Name:
• Rabbit Anti-Pin1 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human Pin1 aa 1-50 (N terminal). The exact sequence is proprietary. (NP_006212.1). Sequence: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQG

• Species Reactivity:
• Mouse, Human Predicted to work with: Rat

• Isotype:
• IgG

• Application:
• ICC/IF, IHC-P

• Storage Buffer:
• pH: 7.40 Preservative: 0.02% Sodium azide Constituents: 49% PBS, 50% Glycerol, 0.87% Sodium chloride PBS without Mg2+ and Ca2+.

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid