Rabbit Anti-PILRA Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-32301P

• Product Name:
• Rabbit Anti-PILRA Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide corresponding to a region within N-terminal aa 51-100 (IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFL N) of Human PILRA isoform 3 (NP_840057). Note: this aminoacid sequence is identical in all 4 isoforms of human PILRA.

• Species Reactivity:
• Human

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid