Rabbit Anti-Phospholipase D2 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-32121P

• Product Name:
• Rabbit Anti-Phospholipase D2 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide ( TATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQS ) corresponding to a region within the N terminal aa 2-51 of Human Phospholipase D2 (NP_002654)

• Species Reactivity:
• Human Predicted to work with: Rabbit, Horse, Cow, Cat, Dog

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: None Constituents: 2% Sucrose, PBS

• Storage Procedures:
• Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid