Cat#:FPA-32005P;Product Name:Rabbit Anti-PHF22 Polyclonal Antibody;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human PHF22 aa 283-355. Sequence: SSSVTSGLTGWAAFAAKTSSAGPSTAKLSSTTQNNTGKPATSSANQKPVG LTGLATSSKGGIGSKIGSNNSTT ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey, Orangutan;Isotype:IgG;Application:ICC/IF;Storage Buffer:pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 40% Glycerol, PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;