Rabbit Anti-PHF19 Polyclonal Antibody Online Inquiry

• Cat#:
• FPA-31998P

• Product Name:
• Rabbit Anti-PHF19 Polyclonal Antibody

• Host Species:
• Rabbit

• Immunogen:
• Synthetic peptide within Human PHF19 aa 530-580 (C terminal). The exact sequence is proprietary. (NP_056466.1). Sequence: SSLSHLKSSITNYFGAAGRLACGEKYQVLARRVTPEGKVQYLVEWEGTTP Y

• Species Reactivity:
• Mouse, Rat, Human Predicted to work with: Rabbit, Horse, Cow, Dog, Zebrafish, Rhesus monkey, Gorilla, Orangutan, Xenopus tropicalis

• Isotype:
• IgG

• Application:
• WB

• Storage Buffer:
• Preservative: 0.09% Sodium azide Constituent: 99% Tris citrate/phosphate pH 7 to 8

• Storage Procedures:
• Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

• Clonality:
• Polyclonal

• Form:
• Liquid